DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and Cd209a

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001099374.1 Gene:Cd209a / 288375 RGDID:1308239 Length:240 Species:Rattus norvegicus


Alignment Length:130 Identity:36/130 - (27%)
Similarity:61/130 - (46%) Gaps:17/130 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 NYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISGNDLGTEG 118
            |.|:.....| :|..:|.||..:.|.|..|:.:.|...|.|..|.:|     |.|:...|:..|.
  Rat   120 NCYFFSVAQK-SWNDSATACHNVGAQLVVIKSEEEQNFLQKTSKKRG-----YTWMGLIDINKES 178

  Fly   119 AFYWMSNGRPMTYA---PWNGPKQMPDNYGGNENCVHMFATREMINDANCKIQMLYVCEATEPKT 180
            .::|: :|.|:|..   .||  |..|:|. |:::|...  ..:..||..|..:..::|:  :|:|
  Rat   179 TWHWV-DGSPLTLTFMKYWN--KGEPNNV-GDKDCAEF--REDGWNDTKCDNKKFWICK--KPET 235

  Fly   181  180
              Rat   236  235

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 32/121 (26%)
Cd209aNP_001099374.1 CLECT_DC-SIGN_like 110..232 CDD:153060 34/125 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5307
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.