DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and Clec4a1

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_955015.1 Gene:Clec4a1 / 269799 MGIID:3036291 Length:245 Species:Mus musculus


Alignment Length:208 Identity:42/208 - (20%)
Similarity:69/208 - (33%) Gaps:67/208 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLILTSVGIPSL-------------------AYLPDVNIFTNYRTEVYNGIPSEIDTTPFVRIG 52
            ||.||.||.:..|                   |.|..|...::...:|::..|.  :..||    
Mouse    63 LLAILFSVALIILFQMYSDLLEEKYTLERLNHARLHCVKNHSSVEDKVWSCCPK--NWKPF---- 121

  Fly    53 DNYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISGNDLGTE 117
            |::.|....:..:|.::...|.:..|||..|:.:.|.:.:.                  |.|...
Mouse   122 DSHCYFTSRDTASWSKSEEKCSLRGAHLLVIQSQEEQDFIT------------------NTLNPR 168

  Fly   118 GAFYWMSNGRPMTYAPWNGPKQMP----------DNYGGN-ENCVHM----------FATREMIN 161
            .|:| :....|..:..|....|.|          |...|| |.||.:          ::......
Mouse   169 AAYY-VGLSDPKGHGQWQWVDQTPYDQNATSWHSDEPSGNTEFCVVLSYHPNVKGWGWSVAPCDG 232

  Fly   162 DAN--CKIQMLYV 172
            |..  |:::.|||
Mouse   233 DHRLICEMRQLYV 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 27/141 (19%)
Clec4a1NP_955015.1 CLECT_DC-SIGN_like 114..240 CDD:153060 28/150 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X73
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.