DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and Clec4a2

DIOPT Version :10

Sequence 1:NP_572491.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001163804.1 Gene:Clec4a2 / 26888 MGIID:1349412 Length:262 Species:Mus musculus


Alignment Length:68 Identity:17/68 - (25%)
Similarity:21/68 - (30%) Gaps:30/68 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 SPPSQPKENPF------NSVFRQKRRSTF----SGLPAWCQ--------------------CEPT 100
            ||..|.....|      |....|:||.|.    :||..|.:                    ||||
Mouse    97 SPTGQQYPATFGDLRAVNGQVPQRRRITSIQPPTGLQEWLRTFQSWSGPEKLLALDELIDSCEPT 161

  Fly   101 KPK 103
            :.|
Mouse   162 QVK 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_572491.1 CLECT 55..174 CDD:153057 17/68 (25%)
Clec4a2NP_001163804.1 CLECT_DC-SIGN_like 131..257 CDD:153060 8/34 (24%)

Return to query results.
Submit another query.