powered by:
Protein Alignment CG12111 and Clec4a2
DIOPT Version :10
| Sequence 1: | NP_572491.1 |
Gene: | CG12111 / 31796 |
FlyBaseID: | FBgn0030050 |
Length: | 188 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_001163804.1 |
Gene: | Clec4a2 / 26888 |
MGIID: | 1349412 |
Length: | 262 |
Species: | Mus musculus |
| Alignment Length: | 68 |
Identity: | 17/68 - (25%) |
| Similarity: | 21/68 - (30%) |
Gaps: | 30/68 - (44%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 66 SPPSQPKENPF------NSVFRQKRRSTF----SGLPAWCQ--------------------CEPT 100
||..|.....| |....|:||.|. :||..|.: ||||
Mouse 97 SPTGQQYPATFGDLRAVNGQVPQRRRITSIQPPTGLQEWLRTFQSWSGPEKLLALDELIDSCEPT 161
Fly 101 KPK 103
:.|
Mouse 162 QVK 164
|
Known Domains:
Indicated by green bases in alignment.
Return to query results.
Submit another query.