DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and CLEC4E

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_055173.1 Gene:CLEC4E / 26253 HGNCID:14555 Length:219 Species:Homo sapiens


Alignment Length:123 Identity:34/123 - (27%)
Similarity:56/123 - (45%) Gaps:13/123 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 YIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISGNDLGTEGAFY 121
            |....:.::|..:...|..|.|||..|..:.|.| .:.|.|.|..:    |:|..:|...||.:.
Human    92 YFFSTDTISWALSLKNCSAMGAHLVVINSQEEQE-FLSYKKPKMRE----FFIGLSDQVVEGQWQ 151

  Fly   122 WMSNGRPMT--YAPWNGPKQMPDNYGGNENCVHMFAT---REMINDANCKIQMLYVCE 174
            |: :|.|:|  .:.|:..:  |:|....|:|..|..:   |:..||..|.:....:||
Human   152 WV-DGTPLTKSLSFWDVGE--PNNIATLEDCATMRDSSNPRQNWNDVTCFLNYFRICE 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 32/121 (26%)
CLEC4ENP_055173.1 CLECT_DC-SIGN_like 80..207 CDD:153060 34/123 (28%)
Confers specificity for glucose/mannose-type carbohydrates. /evidence=ECO:0000303|PubMed:24101491 169..171 0/3 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 57 1.000 Inparanoid score I5418
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.