DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and Sftpa1

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001257574.1 Gene:Sftpa1 / 24773 RGDID:3665 Length:258 Species:Rattus norvegicus


Alignment Length:171 Identity:44/171 - (25%)
Similarity:68/171 - (39%) Gaps:29/171 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 GIPSL-AYLPDVNIFTNYRTEVYNGIPSEIDTT--------PFVRIGDNYYYIEPMNKVNWFQAA 70
            |:|.. |||.:     ..:||:|. |..:|..|        ..:.:||..:.....: ||:....
  Rat   105 GLPGFPAYLDE-----ELQTELYE-IKHQILQTMGVLSLQGSMLSVGDKVFSTNGQS-VNFDTIK 162

  Fly    71 GACRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISGNDLGTEGAFYWMSNGRPMTYAPW- 134
            ..|.....::|......|.||:....|    |.|:|.::...:..|.|.|::: :|..:.|..| 
  Rat   163 EMCTRAGGNIAVPRTPEENEAIASIAK----KYNNYVYLGMIEDQTPGDFHYL-DGASVNYTNWY 222

  Fly   135 -NGPKQMPDNYGGNENCVHMFATREMINDANCKIQMLYVCE 174
             ..|:..     |.|.||.|: |....||..|....|.|||
  Rat   223 PGEPRGQ-----GKEKCVEMY-TDGTWNDRGCLQYRLAVCE 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 29/120 (24%)
Sftpa1NP_001257574.1 Collagen 37..108 CDD:189968 1/2 (50%)
CLECT_collectin_like 146..258 CDD:153061 32/124 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.