DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and Cd207

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_659192.2 Gene:Cd207 / 246278 MGIID:2180021 Length:331 Species:Mus musculus


Alignment Length:125 Identity:37/125 - (29%)
Similarity:58/125 - (46%) Gaps:13/125 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 NYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISGNDLGTEG 118
            |:||.....| .|:.|...|....|||.|:..:.|.:.|  |..|.|..:    ||.....|:||
Mouse   208 NFYYFSRTPK-TWYSAEQFCISRKAHLTSVSSESEQKFL--YKAADGIPH----WIGLTKAGSEG 265

  Fly   119 AFYWM---SNGRPMTYAPWNGPKQMPDNYGGNENCVHM-FATREMINDANCKIQMLYVCE 174
            .:||:   |..:..:...|. |.: |:|.|.||:|.:: .:..:..||..|....|::|:
Mouse   266 DWYWVDQTSFNKEQSRRFWI-PGE-PNNAGNNEHCANIRVSALKCWNDGPCDNTFLFICK 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 35/122 (29%)
Cd207NP_659192.2 CLECT_DC-SIGN_like 201..324 CDD:153060 37/125 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.