DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and Reg3g

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_775120.1 Gene:Reg3g / 24620 RGDID:3256 Length:174 Species:Rattus norvegicus


Alignment Length:131 Identity:35/131 - (26%)
Similarity:58/131 - (44%) Gaps:15/131 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GDNYYYIEPMNKVNWFQAAGAC-RMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISGND-- 113
            |...|.:..::| :||.|..|| :..:.||.|:....|...:...:|:.| .:....||..:|  
  Rat    48 GSYCYALFSVSK-SWFDADLACQKRPSGHLVSVLSGSEASFVSSLIKSSG-NSGQNVWIGLHDPT 110

  Fly   114 LGTE---GAFYWMSNGRPMTYAPWNGPKQMPDNYGGNENCVHMFATREMI--NDANCKIQMLYVC 173
            ||.|   |.:.| ||...|.|..|   :..|.:..|: :|..:......:  .:.||..::.|||
  Rat   111 LGQEPNRGGWEW-SNADVMNYFNW---ETNPSSVSGS-HCGTLTRASGFLRWRENNCISELPYVC 170

  Fly   174 E 174
            :
  Rat   171 K 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 33/126 (26%)
Reg3gNP_775120.1 CLECT_REG-1_like 40..172 CDD:153064 35/131 (27%)
EPN. /evidence=ECO:0000250 114..116 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.