DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and clec-89

DIOPT Version :10

Sequence 1:NP_572491.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001293152.1 Gene:clec-89 / 24104193 WormBaseID:WBGene00015631 Length:324 Species:Caenorhabditis elegans


Alignment Length:167 Identity:36/167 - (21%)
Similarity:66/167 - (39%) Gaps:32/167 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 YRTEVYNGIPSEIDTTPFVRIGDNYYYIEP--------MNKVNWFQAAGACRMM----NAHLASI 83
            :.|.|...||    .|.|.....::::.||        ..::...:|...|:.|    :||:..:
 Worm    15 FSTTVGLSIP----PTTFPNCPKSWHHDEPGRTCYHLARRRMRLTEAHSYCQKMIADGSAHVLRV 75

  Fly    84 EDKPEMEALIKYMKAKGFKNNDYFWISGN---DL--GTEGAF-----YWMSNGRPMTYAPWNGPK 138
            |...|.:.:...:|.    :::..||...   |:  |..|.|     |...||:.:.|:.|....
 Worm    76 ECGGENDFISGLVKG----HSEKVWIDARARFDIVDGAAGLFGPGFVYRWPNGKIVRYSNWANGN 136

  Fly   139 QMPDNYGGNEN-CVHMFATREMINDANCKIQMLYVCE 174
            .:.:....|.| |:::.:....:| |||......:||
 Worm   137 GLEEVGSSNSNKCINIKSDGHWMN-ANCSSTAAVICE 172

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_572491.1 CLECT 55..174 CDD:153057 28/141 (20%)
clec-89NP_001293152.1 CLECT 31..172 CDD:214480 28/145 (19%)
CLECT 183..321 CDD:214480
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.