Sequence 1: | NP_001259341.1 | Gene: | CG12111 / 31796 | FlyBaseID: | FBgn0030050 | Length: | 188 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_775598.2 | Gene: | Colec10 / 239447 | MGIID: | 3606482 | Length: | 277 | Species: | Mus musculus |
Alignment Length: | 127 | Identity: | 36/127 - (28%) |
---|---|---|---|
Similarity: | 60/127 - (47%) | Gaps: | 7/127 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 53 DNYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISGNDLGTE 117
Fly 118 GAFYWMSNGRPMTYAPWNGPKQMPDNYGGNENCVHMFATREMINDANCKIQMLYVCEATEPK 179 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12111 | NP_001259341.1 | CLECT | 55..174 | CDD:153057 | 33/118 (28%) |
Colec10 | NP_775598.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 41..103 | ||
Collagen | 45..93 | CDD:189968 | |||
CLECT_collectin_like | 157..272 | CDD:153061 | 34/121 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | otm43824 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |