DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and Klrh1

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001014997.1 Gene:Klrh1 / 232415 MGIID:2685002 Length:223 Species:Mus musculus


Alignment Length:136 Identity:24/136 - (17%)
Similarity:57/136 - (41%) Gaps:28/136 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 GDNYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPE---MEALIKYMKAKGFKNNDYFWISGND 113
            |..|::.|  .:..|.::..:|:::.:.||.|:.:.|   :::.:.|.          :|:..:.
Mouse   109 GKCYFFSE--EEKTWDESEASCKVLGSLLAKIDSREEQNFIQSQVNYS----------YWVGLHK 161

  Fly   114 LGTEGAFYWM--SNGRPMTYAPWNGPKQMPDNYGGNENCVHMFATREMINDANCKIQMLYVCEA- 175
            .|::  |.|:  .:.:..:...::....:.|...|       :...:.:|.|.|.....|:|:. 
Mouse   162 KGSQ--FQWVHHKDAKLSSDLDFHTATHVADAECG-------YIKPKNLNVAPCHRYFYYICKRN 217

  Fly   176 -TEPKT 180
             |.|.|
Mouse   218 FTCPMT 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 19/123 (15%)
Klrh1NP_001014997.1 Ly49 31..114 CDD:285577 2/4 (50%)
CLECT_NK_receptors_like 100..216 CDD:153063 21/127 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.