DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and FCER2

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001207429.1 Gene:FCER2 / 2208 HGNCID:3612 Length:321 Species:Homo sapiens


Alignment Length:149 Identity:41/149 - (27%)
Similarity:61/149 - (40%) Gaps:14/149 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 TNYRTEVYNGIPSEIDTTP--FVRIGDNYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEA 91
            |..|.|:........:|.|  ::......||.....| .|..|..||..|...|.||....|.:.
Human   146 TKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTK-QWVHARYACDDMEGQLVSIHSPEEQDF 209

  Fly    92 LIKYMKAKGFKNNDYFWISGNDLGTEGAFYWMSNGRPMTYAPWNGPKQMPDNYGGNENCVHMFAT 156
            |.|:....|      .||...:|..:|.|.|: :|..:.|:.| .|.: |.:....|:||.|..:
Human   210 LTKHASHTG------SWIGLRNLDLKGEFIWV-DGSHVDYSNW-APGE-PTSRSQGEDCVMMRGS 265

  Fly   157 REMINDANCKIQM-LYVCE 174
            ... |||.|..:: .:||:
Human   266 GRW-NDAFCDRKLGAWVCD 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 35/119 (29%)
FCER2NP_001207429.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 66..85
Repetitive region 69..89
RILP-like <77..153 CDD:304877 3/6 (50%)
Repetitive region 90..110
Repetitive region 111..131
CLECT 163..282 CDD:214480 35/129 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 290..321
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X73
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.