Sequence 1: | NP_001259341.1 | Gene: | CG12111 / 31796 | FlyBaseID: | FBgn0030050 | Length: | 188 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_507917.2 | Gene: | clec-262 / 191051 | WormBaseID: | WBGene00013831 | Length: | 333 | Species: | Caenorhabditis elegans |
Alignment Length: | 200 | Identity: | 41/200 - (20%) |
---|---|---|---|
Similarity: | 66/200 - (33%) | Gaps: | 75/200 - (37%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MYRTETLLLILTSVGIPSLAY--LPDVNIFTNYRTEVYNGIPSEIDTTPFVRIGDNYYYIEPMNK 63
Fly 64 VNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISG-------ND-------- 113
Fly 114 LGTEGAFYWMSNGRPMTYAPWNGPKQMPD--NYGGNENCVHMFATREMI--------------ND 162
Fly 163 ANCKI 167 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG12111 | NP_001259341.1 | CLECT | 55..174 | CDD:153057 | 26/143 (18%) |
clec-262 | NP_507917.2 | CW | 20..113 | CDD:214742 | |
CLECT | 161..325 | CDD:153057 | 39/191 (20%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1509611at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.010 |