DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and clec-203

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_503376.2 Gene:clec-203 / 190095 WormBaseID:WBGene00021744 Length:355 Species:Caenorhabditis elegans


Alignment Length:215 Identity:43/215 - (20%)
Similarity:66/215 - (30%) Gaps:70/215 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 TSVGIPSLAYLPDVNIFTNYRTEVYNGIPSEIDTTPFVRIGDNYYYIEPM---------NKVNWF 67
            |...:|.....|...|..|:.....|...:::.|.|    .|...|..|.         .|::..
 Worm   153 TITALPVSGERPISTIIVNHGENHENPPLAQVATCP----DDWMTYERPQGRWCMKAFYGKMSQS 213

  Fly    68 QAAGACRMMNAHLASIEDKPE-------MEALI------KYMKAKGFKN-------------NDY 106
            .|...|..:.|.|:.:::..|       :..|:      ||....|.|.             |..
 Worm   214 DAEAECNAVGAKLSGLQNANERMNISYVLRDLVYKDGGGKYTAWLGGKRKASCPTGASCARLNSI 278

  Fly   107 FWISGNDLGTEGAFYWMSNG-RPM--TYAPWNGPKQMPDNYGGNENCVHMFAT------------ 156
            .|..|:..||:|    .|.| |.:  ||.         ..:.|.:.|:||..|            
 Worm   279 EWTDGHTTGTDG----FSTGTRELDGTYL---------QKFRGVQQCLHMIVTPYSDTELGFADF 330

  Fly   157 -REMINDANCKIQML--YVC 173
             ...::|..|....:  |||
 Worm   331 VHGSVDDEFCTATWVKAYVC 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 34/172 (20%)
clec-203NP_503376.2 CLECT 187..350 CDD:214480 34/179 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.