DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and clec-38

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_507233.2 Gene:clec-38 / 188900 WormBaseID:WBGene00012025 Length:382 Species:Caenorhabditis elegans


Alignment Length:227 Identity:51/227 - (22%)
Similarity:76/227 - (33%) Gaps:68/227 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 ILTSVGIPSLAYLPDV------------------NIFTNYRTEVYNGIPSE--IDTTP------- 47
            ||..||....|.|||.                  .:.||..|.. .|.||.  ..|||       
 Worm    59 ILFFVGSADCAQLPDYTTSPASQLTTSAISSRTSEVQTNAITTT-QGTPSNKTSTTTPSTSKVIC 122

  Fly    48 ---FVRIGDNYYYIEPMNKVNWFQAAGACR-MMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFW 108
               |..:|.....:...|:.. .:|...|: ...:.|.|:.::.|...::.::|.   .|.|:.|
 Worm   123 ASGFTLVGTKCGKLVSSNQPR-TEADSICKGYGGSTLFSVRNEQETRDMLDFVKD---SNIDFLW 183

  Fly   109 --ISGNDLGTEGAFYWMSNGRPMTYAPWNG-----PKQMPDNYGGNENCVHMFATREMINDA--- 163
              :..|........:.:.:|   |.|.:|.     |..:   ||   .|::...|.   |.|   
 Worm   184 TGLVCNQTARTSCIWDVKSG---TTADYNNFADGFPNVV---YG---YCIYFIVTG---NSAGQW 236

  Fly   164 ---NCKIQMLYVCEATEPKTF-----KFTYIK 187
               .|...|.:|||.  |.|.     |:.|.|
 Worm   237 GSEQCSQLMNFVCEL--PTTIRDPDCKYNYNK 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 25/132 (19%)
clec-38NP_507233.2 CLECT 122..250 CDD:214480 27/143 (19%)
CLECT 264..377 CDD:214480 2/3 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.