DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and clec-183

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_501639.1 Gene:clec-183 / 188635 WormBaseID:WBGene00011855 Length:216 Species:Caenorhabditis elegans


Alignment Length:139 Identity:29/139 - (20%)
Similarity:43/139 - (30%) Gaps:53/139 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 EVYNGIPSEIDTTPFVRIGDNYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKA 98
            :||||.                        |:..||:.||..:.|.|:..|...|...:.:..|.
 Worm    73 KVYNGF------------------------VHQDQASQACIRIGAELSGSESSAERAVIARLGKE 113

  Fly    99 KGFKNNDY----------------FW--ISGNDLGTEGAFYWMSNGRPMTYAPWNGPKQMPDNYG 145
            :....:||                .|  ..||:.|.:....| |.|.|          |:....|
 Worm   114 RMLAASDYKFGTIRVGIARPTTTRAWALTDGNNDGGQQGIQW-SKGEP----------QLGPTSG 167

  Fly   146 GNENCVHMF 154
            .:.||..|:
 Worm   168 YSHNCALMW 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 25/118 (21%)
clec-183NP_501639.1 CLECT 70..180 CDD:153057 29/139 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.