powered by:
Protein Alignment CG12111 and clec-113
DIOPT Version :9
Sequence 1: | NP_001259341.1 |
Gene: | CG12111 / 31796 |
FlyBaseID: | FBgn0030050 |
Length: | 188 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_493450.1 |
Gene: | clec-113 / 185945 |
WormBaseID: | WBGene00009822 |
Length: | 286 |
Species: | Caenorhabditis elegans |
Alignment Length: | 66 |
Identity: | 16/66 - (24%) |
Similarity: | 29/66 - (43%) |
Gaps: | 11/66 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 126 GRPMTYAPWNGPKQMPDNYGGNENCVHM---FATREMINDANCKI----QMLYVCEATEPK-TFK 182
|.|..|:.::.|....|.: |:|:.. .:|...:.:.||:: |:......:|.| .||
Worm 6 GEPGVYSSYSNPLPSTDTW---EDCLEYCLGLSTCVAVYNNNCQMFEIGQISTATSTSETKIAFK 67
Fly 183 F 183
|
Worm 68 F 68
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG12111 | NP_001259341.1 |
CLECT |
55..174 |
CDD:153057 |
11/54 (20%) |
clec-113 | NP_493450.1 |
PAN_3 |
1..67 |
CDD:369790 |
13/63 (21%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1509611at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.