DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and Reg3b

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_035166.1 Gene:Reg3b / 18489 MGIID:97478 Length:175 Species:Mus musculus


Alignment Length:178 Identity:45/178 - (25%)
Similarity:68/178 - (38%) Gaps:30/178 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 LLILTSV-GIPSLAYLPDVNIFTNYRTEVYNGIPSEIDTTPFVRIGDNYYYIEPMNKVNWFQAAG 71
            |::|:.| |..||..:|...|.....::.|.                :|.|........||.|..
Mouse    18 LMLLSQVQGEDSLKNIPSARISCPKGSQAYG----------------SYCYALFQIPQTWFDAEL 66

  Fly    72 AC-RMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISGND--LGTE---GAFYWMSNGRPMT 130
            || :....||.|:.:..|...|...:|..| .:..|.||..:|  ||.|   |.:.| ||...|.
Mouse    67 ACQKRPGGHLVSVLNSAEASFLSSMVKRTG-NSYQYTWIGLHDPTLGAEPNGGGWEW-SNNDVMN 129

  Fly   131 YAPWNGPKQMPDNYGGNENCVHMFATREMI--NDANCKIQMLYVCEAT 176
            |..|   ::.|........|..:......:  .|..|::::.|||:.|
Mouse   130 YFNW---ERNPSTALDRAFCGSLSRASGFLKWRDMTCEVKLPYVCKFT 174

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 34/126 (27%)
Reg3bNP_035166.1 CLECT_REG-1_like 40..173 CDD:153064 36/153 (24%)
EPN. /evidence=ECO:0000250 114..116 1/1 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X73
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.