DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and clec-151

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_497944.2 Gene:clec-151 / 184310 WormBaseID:WBGene00008659 Length:591 Species:Caenorhabditis elegans


Alignment Length:139 Identity:31/139 - (22%)
Similarity:49/139 - (35%) Gaps:38/139 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 YNGIPSEIDTTPFVRIGD----NYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYM 96
            |:..|......|.|..|.    .|.:..|:   .:..|...|..|.|||:....:.|.:.|.:.:
 Worm   395 YSKCPEGFSEFPRVTSGQRWCHKYVHGAPL---PYDDAEKKCAEMGAHLSGFTTQEEFKFLNELV 456

  Fly    97 KAKGFKNNDYFWISGNDLGTEGAFYWMSNGRPMTYAPWNGPKQMPD---NYGGNENCVHMFATRE 158
                  |.:|  .:.||:..     |:...|.|:         .||   |:.|.      |:|.|
 Worm   457 ------NKEY--PNKNDIEV-----WLGAQRKMS---------CPDAGKNFNGG------FSTNE 493

  Fly   159 MINDANCKI 167
            ..|.|..::
 Worm   494 FDNCARSRV 502

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 26/116 (22%)
clec-151NP_497944.2 CLECT 98..>129 CDD:382969
CLECT 398..578 CDD:214480 30/136 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.