DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and clec-50

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_507830.1 Gene:clec-50 / 180299 WormBaseID:WBGene00012253 Length:321 Species:Caenorhabditis elegans


Alignment Length:123 Identity:37/123 - (30%)
Similarity:55/123 - (44%) Gaps:17/123 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 NKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKN---NDYFWISGNDLGTEGAFYWM 123
            :...|..|..||.::.|||.|:..:.| ...:..:.:.|.|.   .|..||..:.:|.:  :.| 
 Worm   200 HNAKWEDAEAACVLLGAHLTSVHSETE-NTFVANLASCGIKEGNPKDLAWIGMHKVGQD--WVW- 260

  Fly   124 SNGRPMTYAPWNGPKQMPDNYGGNENCVHMFAT------REMINDANCKIQM-LYVCE 174
            ::|.|..|..| .||| ||| .|.||||.....      .|..|:..|..:| .|:|:
 Worm   261 TDGTPSNYINW-APKQ-PDN-PGKENCVETAPDLSHDKWYENWNNEACSTEMRAYICK 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 36/121 (30%)
clec-50NP_507830.1 CLECT 26..146 CDD:214480
CLECT 182..315 CDD:214480 36/121 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X73
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.