DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and clec-48

DIOPT Version :10

Sequence 1:NP_572491.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_507547.1 Gene:clec-48 / 180188 WormBaseID:WBGene00007565 Length:321 Species:Caenorhabditis elegans


Alignment Length:78 Identity:24/78 - (30%)
Similarity:40/78 - (51%) Gaps:7/78 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 CRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDY--FWISGNDLGTEGAFYWMSNGRPMTYAPWN 135
            |.::..||||:::..| .||::...|..||.::|  :||..|||.|.|.:.|........|:.| 
 Worm    50 CNLLGGHLASVQNGQE-NALLQSNAANSFKKSNYSDYWIGANDLETSGTWKWTDPSVTFDYSNW- 112

  Fly   136 GPKQMPDNYGGNE 148
               |:.:...|::
 Worm   113 ---QLGEPQSGSD 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_572491.1 CLECT 55..174 CDD:153057 24/78 (31%)
clec-48NP_507547.1 CLECT 26..146 CDD:214480 24/78 (31%)
CLECT 182..315 CDD:214480
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.