DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and clec-83

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_500260.3 Gene:clec-83 / 177065 WormBaseID:WBGene00021879 Length:237 Species:Caenorhabditis elegans


Alignment Length:133 Identity:29/133 - (21%)
Similarity:55/133 - (41%) Gaps:23/133 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SVGIPSLAYLPDVNIFTNYRTEVYNGIPSEIDTTPFVRIGDNYYYIEPMNKVNWFQAAGACRMMN 77
            |:.:|.|       :.|:..::..:|..|         ||| ..|:....::::..|.|.|..::
 Worm     7 SIALPLL-------LTTSVHSQCASGDNS---------IGD-LCYVVVNQQLSYQDAVGYCHGIS 54

  Fly    78 AHLASIEDKPEMEALIKYMKAKGFKNNDYFWISGNDLGTEGAFYWMSNGRPMTYAPW--NGPKQM 140
            ..||.:....:...|...::.|...::..|||..:...:...|.| .:|..|.::.:  |.||  
 Worm    55 TSLAVVHTTLQANFLASTIRTKTGTSDSLFWIGLSRASSSSRFTW-DDGSVMYWSNFDLNFPK-- 116

  Fly   141 PDN 143
             ||
 Worm   117 -DN 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 20/91 (22%)
clec-83NP_500260.3 CLECT 22..143 CDD:214480 25/111 (23%)
PAP1 110..>236 CDD:369990 5/12 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.