DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and ACAN

DIOPT Version :10

Sequence 1:NP_572491.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001356197.1 Gene:ACAN / 176 HGNCID:319 Length:2568 Species:Homo sapiens


Alignment Length:97 Identity:27/97 - (27%)
Similarity:33/97 - (34%) Gaps:28/97 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 SPPSQPKENPFNSVFRQKRRSTFSGLPAWCQCEPTKPKCPRGPP--GPPGHPGQRGIPGIPGRNG 128
            |||||....|        ..|.....|:...|    ||..|.|.  .||..| |..:...|..:.
Human   658 SPPSQGDPGP--------SLSKLDPRPSQSPC----PKLLRVPTRHSPPESP-QLLVSTEPNSDA 709

  Fly   129 QDNYNTIRAPACP-----PRNQDCIKCPAGPP 155
            .....:|.:|:|.     ||||        ||
Human   710 VQRLQSISSPSCSHSAENPRNQ--------PP 733

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_572491.1 CLECT 55..174 CDD:153057 27/97 (28%)
ACANNP_001356197.1 Ig_Aggrecan 33..155 CDD:409481
Ig strand A 33..36 CDD:409481
Ig strand A' 39..41 CDD:409481
Ig strand B 45..53 CDD:409481
G1-A 48..141
Ig strand C 72..78 CDD:409481
Ig strand C' 83..86 CDD:409481
Ig strand D 104..109 CDD:409481
Ig strand E 115..121 CDD:409481
Ig strand F 129..136 CDD:409481
Ig strand G 146..155 CDD:409481
G1-B 152..247
Link_domain_CSPGs_modules_1_3 153..247 CDD:239594
G1-B' 253..349
Link_domain_CSPGs_modules_2_4 254..349 CDD:239597
G2-B 477..571
Link_domain_CSPGs_modules_1_3 478..572 CDD:239594
G2-B' 578..673 7/22 (32%)
Link_domain_CSPGs_modules_2_4 579..674 CDD:239597 7/23 (30%)
KS 677..849 19/70 (27%)
PHA03307 716..>975 CDD:223039 9/26 (35%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 734..979 27/97 (28%)
12 X 6 AA approximate tandem repeats of E-[GVE]-P-[SFY]-[APT]-[TSP] 773..844
CS-1 852..1612
35 X 19 AA approximate tandem repeats of E-[IVDG]-[LV]-[EV]-[GTI]-[STA]-[ATV]-[SP]-[GA]-[VIFAD]- [GEDL]-[DE]-[LVI]-[SG]-[GERK]-[LV]-P-S-G 942..1612
PRK15387 <1433..>1614 CDD:185285
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1499..1526
TamB 1511..2016 CDD:442155
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1543..1649
CS-2 1613..2277
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1687..1772
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1784..1827
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1883..1902
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1948..1977
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2048..2204
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2249..2281
EGF_CA 2283..2313 CDD:238011
EGF_CA 2316..2352 CDD:238011
CLECT_CSPGs 2358..2481 CDD:153058
CCP 2485..2541 CDD:153056
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 2548..2568
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.