DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and Clec4d

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_034949.3 Gene:Clec4d / 17474 MGIID:1298389 Length:219 Species:Mus musculus


Alignment Length:128 Identity:29/128 - (22%)
Similarity:52/128 - (40%) Gaps:20/128 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 NYYYIEPMN-KVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISGNDLGTE 117
            |.|:  |:| ...|.::...|..|::||.:|..:.|...:.:.:.    |...|| :...|...|
Mouse    93 NCYF--PLNDNQTWHESERNCSGMSSHLVTINTEAEQNFVTQLLD----KRFSYF-LGLADENVE 150

  Fly   118 GAFYWMSNGRPMTYAPWNGPKQMPDNYGGN----ENCVHMFATRE--MINDANCKIQMLYVCE 174
            |.:.|:..      .|:|......:....|    |:||.:....|  :.||..|..::..:|:
Mouse   151 GQWQWVDK------TPFNPHTVFWEKGESNDFMEEDCVVLVHVHEKWVWNDFPCHFEVRRICK 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 27/125 (22%)
Clec4dNP_034949.3 CLECT_DC-SIGN_like 83..207 CDD:153060 28/126 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X73
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.