DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and clec-95

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_492868.1 Gene:clec-95 / 173010 WormBaseID:WBGene00013927 Length:229 Species:Caenorhabditis elegans


Alignment Length:145 Identity:25/145 - (17%)
Similarity:43/145 - (29%) Gaps:36/145 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 KVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISG------------NDLG 115
            ::|...|...|:...|.|:.:.:..|...:.....:...:::...|:..            ....
 Worm    80 RLNQGAAQSQCQSFGATLSGLRNLEEARTISNLALSVIGRSSGGIWLGARRTTACAKQHKTTSCS 144

  Fly   116 TEGAFYWMSNGRPMTYA-PWNGPKQMPDNYGGNENCVHMFATRE------------MINDANCKI 167
            |..:|.|..:....|.. .||..:  |||...|..|..:.|...            |::|..|..
 Worm   145 TTSSFRWTDSSASGTAGFVWNNVQ--PDNSDLNSQCAVLHAGSSAATVSNAVWQPAMMDDVTCSF 207

  Fly   168 QML---------YVC 173
            ...         |||
 Worm   208 DPAGRDPRSIYGYVC 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 25/145 (17%)
clec-95NP_492868.1 CLECT 72..224 CDD:153057 25/145 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.