DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and Cd209a

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_573501.1 Gene:Cd209a / 170786 MGIID:2157942 Length:238 Species:Mus musculus


Alignment Length:175 Identity:44/175 - (25%)
Similarity:78/175 - (44%) Gaps:20/175 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLILTSV-GIPSLAYLPD-VNIFTNYRTEVYNGIPSEIDTTP--FVRIGDNYYYIEPMNKVNWF 67
            |::||..| .|||.....: :|::... |::..|:.....:.|  :.....:.|:.....| :|.
Mouse    68 LVVILVKVYKIPSSQEENNQMNVYQEL-TQLKAGVDRLCRSCPWDWTHFQGSCYFFSVAQK-SWN 130

  Fly    68 QAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISGNDLGTEGAFYWMSNGRPMTYA 132
            .:|.||..:.|.|..|:...|...|.:..|.:|     |.|:...|:..|..:||: :|.|:|.:
Mouse   131 DSATACHNVGAQLVVIKSDEEQNFLQQTSKKRG-----YTWMGLIDMSKESTWYWV-DGSPLTLS 189

  Fly   133 ---PWNGPKQMPDNYGGNENCVHMFATREMINDANCKIQMLYVCE 174
               .|:  |..|:|. |.|:|...  ..:..||..|..:..::|:
Mouse   190 FMKYWS--KGEPNNL-GEEDCAEF--RDDGWNDTKCTNKKFWICK 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 32/121 (26%)
Cd209aNP_573501.1 CLECT_DC-SIGN_like 108..230 CDD:153060 34/134 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5406
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.