DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and Cd209d

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_570974.1 Gene:Cd209d / 170779 MGIID:2157947 Length:237 Species:Mus musculus


Alignment Length:177 Identity:47/177 - (26%)
Similarity:84/177 - (47%) Gaps:26/177 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLILTSVG-IPSLAYLPDV-NIFTNYRTEVYNGI--PSEIDTTPFVRIGDNYYYIEPMNKVNWF 67
            ||:||..|. :||......: ......:.||::|:  |...|.|.|  .|..|::.:  ::.||.
Mouse    68 LLIILILVSKVPSSEVQNKIYQELMQLKAEVHDGLCQPCARDWTFF--NGSCYFFSK--SQRNWH 128

  Fly    68 QAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISGNDLGTEGAFYWMSNGRPMT-- 130
            .:..||:.:.|.|..||...|...|.:..||:|     ..|:..:|:..|..::|: :|.|::  
Mouse   129 NSTTACQELGAQLVIIETDEEQTFLQQTSKARG-----PTWMGLSDMHNEATWHWV-DGSPLSPS 187

  Fly   131 ---YAPWNGPKQMPDNYGGNENCVHMFATREMINDANCKIQMLYVCE 174
               |  ||  :..|:|. |:|:|...  :.:..||.:|...:.::|:
Mouse   188 FTRY--WN--RGEPNNV-GDEDCAEF--SGDGWNDLSCDKLLFWICK 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 31/123 (25%)
Cd209dNP_570974.1 CLECT_DC-SIGN_like 106..228 CDD:153060 36/139 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.