DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and Cd209c

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_017168078.1 Gene:Cd209c / 170776 MGIID:2157945 Length:240 Species:Mus musculus


Alignment Length:184 Identity:49/184 - (26%)
Similarity:80/184 - (43%) Gaps:32/184 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 TLLLILTSVGIPSLAY------LPDVNIF---TNYRTEVYNGI--PSEIDTTPFVRIGDNYYYIE 59
            |:||:...|.:.::||      .....::   |..:::: |.:  |...|.|.|   ..|.|:..
Mouse    65 TILLLAILVKVSNVAYSHGQEQAKKEKVYKEMTQLKSQI-NRLCRPCPWDWTVF---QGNCYFFS 125

  Fly    60 PMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISGNDLGTEGAFYWMS 124
            ...: ||..:..|||.::|.|..|:...|...|.:..|.||     |.|:..:||..||.::|:.
Mouse   126 KFQQ-NWNDSVNACRKLDAQLVVIKSDDEQSFLQQTSKEKG-----YAWMGLSDLKHEGRWHWVD 184

  Fly   125 NGRP----MTYAPWNGPKQMPDNYGGNENCVHMFATREMINDANCKIQMLYVCE 174
            ....    |.|  ||  |..|:| ...|:|...  ..:..|||.|.|:..::|:
Mouse   185 GSHLLFSFMKY--WN--KGEPNN-EWEEDCAEF--RGDGWNDAPCTIKKYWICK 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 35/122 (29%)
Cd209cXP_017168078.1 CLECT_DC-SIGN_like 110..232 CDD:153060 40/138 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 59 1.000 Inparanoid score I5406
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.960

Return to query results.
Submit another query.