DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and Klrb1c

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001153376.1 Gene:Klrb1c / 17059 MGIID:107538 Length:271 Species:Mus musculus


Alignment Length:132 Identity:25/132 - (18%)
Similarity:53/132 - (40%) Gaps:25/132 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LLLILTSVGIPSLAYLPDVNIFTNYRTEVYNGIPSEIDTTPFVRIG-----------DNYYYIEP 60
            :||:||.:|   ::.|..|.:....|.:....|...::.|....:.           |..:::..
Mouse    97 ILLVLTLIG---MSVLVRVLVQKPSREKCCVFIQENLNKTTDCSVNLECPQDWLLHRDKCFHVSQ 158

  Fly    61 MNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAK------GFK----NNDYFWISGNDLG 115
            ::. .|.:....|....|.|..|:|:.|:..|:..:|.|      |.:    :.::.||:|....
Mouse   159 VSN-TWEEGQADCGRKGATLLLIQDQEELRFLLDSIKEKYNSFWIGLRFTLPDMNWKWINGTTFN 222

  Fly   116 TE 117
            ::
Mouse   223 SD 224

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 14/73 (19%)
Klrb1cNP_001153376.1 PHA03097 89..258 CDD:222982 25/132 (19%)
CLECT_NK_receptors_like 142..260 CDD:153063 15/84 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.