powered by:
Protein Alignment CG12111 and LOC110438686
DIOPT Version :9
Sequence 1: | NP_001259341.1 |
Gene: | CG12111 / 31796 |
FlyBaseID: | FBgn0030050 |
Length: | 188 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_021327448.1 |
Gene: | LOC110438686 / 110438686 |
-ID: | - |
Length: | 87 |
Species: | Danio rerio |
Alignment Length: | 69 |
Identity: | 14/69 - (20%) |
Similarity: | 26/69 - (37%) |
Gaps: | 3/69 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 57 YIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISGNDLGTEGAFY 121
:...|:..||.::...||.....|..|:.:.:...:..::.. |.....|:...|...||...
Zfish 16 FFSSMDSKNWSESRQYCRDRGEDLLIIKSEEKQRRVTSFITE---KVKMPVWLGLTDAEIEGNMI 77
Fly 122 WMSN 125
|:.|
Zfish 78 WVDN 81
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG12111 | NP_001259341.1 |
CLECT |
55..174 |
CDD:153057 |
14/69 (20%) |
LOC110438686 | XP_021327448.1 |
CLECT |
16..>86 |
CDD:321932 |
14/69 (20%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1509611at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.