DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and LOC103911722

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_009303414.1 Gene:LOC103911722 / 103911722 -ID:- Length:674 Species:Danio rerio


Alignment Length:134 Identity:26/134 - (19%)
Similarity:48/134 - (35%) Gaps:23/134 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 DTTPFVRIGDNYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFW 108
            |...::....::|||. ..|.:|..:...|:...|.||.|:...|...|.|.::      |:..|
Zfish   559 DNFKWIYFSSSFYYIS-FEKKSWEDSRRDCQQRRADLAIIKSTEEKTFLQKVLQ------NNNLW 616

  Fly   109 ISGNDLGTEGAFYWMSNGRPMTYAPWNGPKQMPDNYGGNE-NCVHMFATREMINDANCKIQMLYV 172
            :.......:.   |:          |.....:.:.:|.:. ||..:..|:..  ...|.....::
Zfish   617 VGWRQTNGDN---WI----------WIDDPLVANGFGSDSINCAVVSETKYF--SYACNTLHGWI 666

  Fly   173 CEAT 176
            ||.|
Zfish   667 CERT 670

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 22/119 (18%)
LOC103911722XP_009303414.1 COG1340 210..505 CDD:224259
CLECT_NK_receptors_like 562..669 CDD:153063 23/128 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.