DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and si:ch73-122g19.1

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_005155331.2 Gene:si:ch73-122g19.1 / 101884707 ZFINID:ZDB-GENE-110411-239 Length:337 Species:Danio rerio


Alignment Length:133 Identity:32/133 - (24%)
Similarity:57/133 - (42%) Gaps:25/133 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 NYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNN-DYFWISGNDLGTE 117
            ::||...::| .|..:...|....|.|..|.::.|.:.:::       |:| ...||..||:..|
Zfish   211 SFYYKSNISK-TWIVSRSDCIARGADLIIINNQQEQDFVMR-------KSNVAAVWIGLNDIIVE 267

  Fly   118 GAFYWMSNGRPM--TYAPWNGPKQMPDNYGGNENCVHMFATREMI---------NDANCKIQMLY 171
            |.:.|: :|..|  ..:.|......| |...|||||   .:.:.:         :|.:|:....:
Zfish   268 GTWRWV-DGSAMKNDLSFWASGSNEP-NGDTNENCV---VSADKVTEWPYTSGWSDVSCERTFQW 327

  Fly   172 VCE 174
            :||
Zfish   328 ICE 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 30/130 (23%)
si:ch73-122g19.1XP_005155331.2 CLECT_DC-SIGN_like 203..331 CDD:153060 32/133 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10954
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.