DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and LOC101734545

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_031750858.1 Gene:LOC101734545 / 101734545 -ID:- Length:471 Species:Xenopus tropicalis


Alignment Length:157 Identity:36/157 - (22%)
Similarity:57/157 - (36%) Gaps:47/157 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 YLPDVNIFTNYRTEVYNGIPSEIDTTPFVRIGDNYYYIEPMNKVNWFQAAGACRMMNAHLASIED 85
            |.|||                      :.:|||..||....::.. .|:..|||...|.||.:| 
 Frog   311 YCPDV----------------------WEQIGDQCYYFSSESQYR-LQSETACRSSGAVLAKLE- 351

  Fly    86 KPEMEALIKYMKAKGFKNNDYFWISGNDL---GTEGAFYWMSNGRPMTYAPWNGPKQMPDNYGGN 147
              |.:.::|.|.||..::   :||....:   |....|.|..|.....       :.:|     |
 Frog   352 --ESDDILKKMIAKSSRS---YWIGLKKVEHQGQTNLFRWSDNSSQTL-------ESLP-----N 399

  Fly   148 ENCVHMFATREMINDANCKIQMLYVCE 174
            :.|..  ||.| :....|...:.::|:
 Frog   400 QFCAK--ATPE-LKAETCSKLLPWICQ 423

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 28/121 (23%)
LOC101734545XP_031750858.1 Smc <87..>306 CDD:224117
CLECT 312..424 CDD:413318 35/156 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.