DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and LOC100363064

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_038945816.1 Gene:LOC100363064 / 100363064 RGDID:2324825 Length:285 Species:Rattus norvegicus


Alignment Length:217 Identity:52/217 - (23%)
Similarity:85/217 - (39%) Gaps:57/217 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RTETLLLILTSVG--IPSLAYLPDVN-IFTNYRTEVYN----------GIPSEIDTTPFVRI--- 51
            |...|||:|.|:|  :..||.|..|: |..|.:.:..:          .:|.|...|...:|   
  Rat    66 RAPWLLLLLISLGLFLLMLAILVQVSRICANPQGQTQDQKGSSSLGKVAVPQEQTHTGLEQIQQI 130

  Fly    52 -----------------------------GDNYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKP 87
                                         |..|.:...:  .:|..:|.:|:.:.|||..|....
  Rat   131 QQIQQQLTQFNASLAGLCRPCPWDWEFFQGSCYLFSRTL--ASWGASASSCKDLGAHLVIINSVA 193

  Fly    88 EMEALIKYMKAKGFKNNDYFWISGNDLGTEGAFYWMSNGRPMTYAPWNGPKQMPDNYGGNENCVH 152
            |.    ::||....:.|...||..:|...||::.|:.:. |:.::.|   |:...|..|:|:||.
  Rat   194 EQ----RFMKYWNVRKNQRSWIGLSDHLREGSWQWVDHS-PLKFSFW---KEGEPNNDGDEDCVE 250

  Fly   153 MFATREMINDANCKIQMLYVCE 174
            :|  .:..||..|..|..:|||
  Rat   251 LF--MDEWNDNTCTQQNFWVCE 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 32/118 (27%)
LOC100363064XP_038945816.1 CLECT_DC-SIGN_like 151..270 CDD:153060 33/130 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 60 1.000 Inparanoid score I5307
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.