DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and cd209

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001186302.2 Gene:cd209 / 100334918 ZFINID:ZDB-GENE-061207-22 Length:343 Species:Danio rerio


Alignment Length:129 Identity:33/129 - (25%)
Similarity:55/129 - (42%) Gaps:29/129 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    54 NYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGF--------KNNDYFWIS 110
            ::|:|....: ||.::...||...|.|..|.::.|.:. :|.|.. ||        .::.:.||.
Zfish   229 SFYFISSEER-NWTESRRYCRDKGADLIIINNREEQDH-VKKMSG-GFTVWIGLTDSDDRWKWID 290

  Fly   111 GNDLGTEGAFYWMSNGRPMTYAPWNGPKQMPDNYGGNENCVHMFATREMINDANCKIQMLYVCE 174
            |.:: |.|..:| ::|.|      ||.        |.||||...::...  |..|.....::||
Zfish   291 GTNM-TTGFRFW-NHGEP------NGQ--------GGENCVTSRSSGWA--DYPCFYPFPWICE 336

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 31/126 (25%)
cd209NP_001186302.2 DivIC 94..183 CDD:299713
CLECT_DC-SIGN_like 220..337 CDD:153060 33/129 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10954
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.