DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and dcsignlg

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_002660626.3 Gene:dcsignlg / 100320246 ZFINID:ZDB-GENE-090313-154 Length:263 Species:Danio rerio


Alignment Length:116 Identity:30/116 - (25%)
Similarity:47/116 - (40%) Gaps:15/116 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 VNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISGNDLGTEG-AFYWMSNGR 127
            ::|.::...||...|.|..|:.:.:...:...:|       :..||..:...|.| .:.|:.|. 
Zfish   157 MSWSESRQFCRDRGADLVIIKSEEKQRFISSLVK-------EDTWIGLSVTETGGNKWKWVDNS- 213

  Fly   128 PMTYAPWNGPKQMPDNY-GGNENCVHM---FATREMINDANCKIQMLYVCE 174
            |:....|  .|..|:|| |..|:||.:   ..|....||..|......|||
Zfish   214 PLNQGFW--AKGEPNNYQGAKEDCVEVRISQGTPNNWNDRRCSDSRKAVCE 262

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 28/114 (25%)
dcsignlgXP_002660626.3 IncA <40..>144 CDD:282066
Uso1_p115_C 78..>146 CDD:282695
CLECT_DC-SIGN_like 144..263 CDD:153060 30/116 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10954
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 55 1.000 Inparanoid score I5439
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.970

Return to query results.
Submit another query.