DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and si:ch73-343l4.8

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:XP_002660625.1 Gene:si:ch73-343l4.8 / 100320176 ZFINID:ZDB-GENE-090313-159 Length:170 Species:Danio rerio


Alignment Length:132 Identity:34/132 - (25%)
Similarity:54/132 - (40%) Gaps:20/132 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 RIGDN---YYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISG 111
            |.|.|   .::|. .|.::|.::...||...|.|..|..:.:...:..:::       |:.||..
Zfish    51 RAGSNRLGLFFIS-NNTMSWSESRQFCRDRGADLVIINTEEKQRFISPFVE-------DFLWIGL 107

  Fly   112 NDLGTEGAFYWMSNGRPMTYAPW-NGPKQMPDNYGGNENCVHMFATREMI---NDANCKIQMLYV 172
            .|...||...|:.|. |:....| :|.   |:|..| ||||.:......:   ||..|......:
Zfish   108 TDEEIEGNMKWVDNS-PLKQGFWVDGE---PNNLNG-ENCVIIVPVENFLKNWNDVPCTFTFKAL 167

  Fly   173 CE 174
            ||
Zfish   168 CE 169

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 29/122 (24%)
si:ch73-343l4.8XP_002660625.1 CLECT_DC-SIGN_like 48..170 CDD:153060 34/132 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 56 1.000 Domainoid score I10954
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1509611at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.