DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and RGD2301395

DIOPT Version :9

Sequence 1:NP_001259341.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001129159.1 Gene:RGD2301395 / 100190921 RGDID:2301395 Length:223 Species:Rattus norvegicus


Alignment Length:126 Identity:26/126 - (20%)
Similarity:47/126 - (37%) Gaps:21/126 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 DNYYYIEPMNKVNWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISGNDLGTE 117
            |..:::...:. .|.::...|....|.|..|:.:.|:..|...:|.||    ..|||        
  Rat   103 DKCFHVSQASN-TWKESLADCDGKGATLLLIQSQEELRFLRYLIKGKG----SSFWI-------- 154

  Fly   118 GAFYWMSNGRPMTYAPW-NGPKQMPD---NYGGNENCVHMFATREMINDANCKIQMLYVCE 174
            |..|.:    |.....| ||....||   .:|..:.......:::.:...:|....|::|:
  Rat   155 GLSYTL----PDRNWKWINGSTLNPDVLSIFGDTKQNSCASVSQDKVLSESCSSDNLWICQ 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_001259341.1 CLECT 55..174 CDD:153057 24/122 (20%)
RGD2301395NP_001129159.1 PHA03097 42..210 CDD:222982 25/123 (20%)
CLECT_NK_receptors_like 94..212 CDD:153063 26/126 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.