DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12111 and si:ch211-225k7.5

DIOPT Version :10

Sequence 1:NP_572491.1 Gene:CG12111 / 31796 FlyBaseID:FBgn0030050 Length:188 Species:Drosophila melanogaster
Sequence 2:NP_001093550.1 Gene:si:ch211-225k7.5 / 100002638 ZFINID:ZDB-GENE-060503-123 Length:364 Species:Danio rerio


Alignment Length:178 Identity:44/178 - (24%)
Similarity:75/178 - (42%) Gaps:36/178 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SVGIPSLAYL-----PDVNIFTNYRTEVYNGIPSEIDTTPFVRIGDNYYYIEPMNK--------V 64
            |.|.|:| ||     |..|  .|..:::.||..|.:...     .:||:....|::        :
Zfish    83 SSGDPAL-YLNLSSSPANN--NNCTSKMRNGQWSVVPCN-----NNNYFICYNMSRGFVFVNQTM 139

  Fly    65 NWFQAAGACRMMNAHLASIEDKPEMEALIKYMKAKGFKNNDYFWISGNDLGTEGAF--YWM-SNG 126
            ||..|...||..:..|.::.::.|.:.|.|::..:.|..:. .||        |.|  .|. |:.
Zfish   140 NWTAAQSYCRQNHTDLVTVRNQNENQQLEKFINDRNFSRSS-VWI--------GLFRDTWQWSDQ 195

  Fly   127 RPMTYAPWNGPKQMPDNYGGNENCVHMFATREM-INDANCKIQMLYVC 173
            ...::..|:..|  |:|.||||:|..:....:. ..:.:|..|..:||
Zfish   196 SNSSFRYWDTGK--PNNSGGNESCTVIGQNSQRGWEEVSCDRQYPFVC 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12111NP_572491.1 CLECT 55..174 CDD:153057 31/131 (24%)
si:ch211-225k7.5NP_001093550.1 CLECT 22..127 CDD:470576 14/51 (27%)
CLECT_1 130..242 CDD:153072 29/123 (24%)
CLECT 248..362 CDD:153057
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.