DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drsl3 and PDF2.5

DIOPT Version :9

Sequence 1:NP_728861.1 Gene:Drsl3 / 317955 FlyBaseID:FBgn0052283 Length:71 Species:Drosophila melanogaster
Sequence 2:NP_201171.1 Gene:PDF2.5 / 836486 AraportID:AT5G63660 Length:73 Species:Arabidopsis thaliana


Alignment Length:59 Identity:15/59 - (25%)
Similarity:24/59 - (40%) Gaps:4/59 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 MTIVLMEANTVL---ARDCLSGTFGGPCWAWSGEKCRRLCIEEGHVSGHCSG-AMKCWC 68
            :.:||..:..::   .|.|.|.:........|...|..:|..||...|.|.| ..:|:|
plant    11 LLLVLFSSQEIIGGEGRTCQSKSHHFKYMCTSNHNCAIVCRNEGFSGGRCHGFHRRCYC 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drsl3NP_728861.1 Gamma-thionin 28..70 CDD:278720 12/42 (29%)
PDF2.5NP_201171.1 Gamma-thionin 30..73 CDD:395240 11/40 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1625543at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.