DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drsl3 and Drsl5

DIOPT Version :10

Sequence 1:NP_728861.1 Gene:Drsl3 / 317955 FlyBaseID:FBgn0052283 Length:71 Species:Drosophila melanogaster
Sequence 2:NP_647803.1 Gene:Drsl5 / 38409 FlyBaseID:FBgn0035434 Length:69 Species:Drosophila melanogaster


Alignment Length:70 Identity:41/70 - (58%)
Similarity:50/70 - (71%) Gaps:1/70 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VQMIFLFAILAVMTIVLMEANTVLARDCLSGTFGGPCWAWSGEKCRRLCIEEGHVSGHCSGAMKC 66
            :|:.||:..||||||.::.|....| |||||.:||||..|..|.|||:|.|||..|||||.::||
  Fly     1 MQIKFLYLFLAVMTIFILGAKEADA-DCLSGRYGGPCAVWDNETCRRVCKEEGRSSGHCSPSLKC 64

  Fly    67 WCEGC 71
            |||||
  Fly    65 WCEGC 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drsl3NP_728861.1 Gamma-thionin 28..70 CDD:395240 27/41 (66%)
Drsl5NP_647803.1 Gamma-thionin 26..68 CDD:395240 27/41 (66%)

Return to query results.
Submit another query.