DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drsl3 and Drsl5

DIOPT Version :9

Sequence 1:NP_728861.1 Gene:Drsl3 / 317955 FlyBaseID:FBgn0052283 Length:71 Species:Drosophila melanogaster
Sequence 2:NP_647803.1 Gene:Drsl5 / 38409 FlyBaseID:FBgn0035434 Length:69 Species:Drosophila melanogaster


Alignment Length:70 Identity:41/70 - (58%)
Similarity:50/70 - (71%) Gaps:1/70 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 VQMIFLFAILAVMTIVLMEANTVLARDCLSGTFGGPCWAWSGEKCRRLCIEEGHVSGHCSGAMKC 66
            :|:.||:..||||||.::.|....| |||||.:||||..|..|.|||:|.|||..|||||.::||
  Fly     1 MQIKFLYLFLAVMTIFILGAKEADA-DCLSGRYGGPCAVWDNETCRRVCKEEGRSSGHCSPSLKC 64

  Fly    67 WCEGC 71
            |||||
  Fly    65 WCEGC 69

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drsl3NP_728861.1 Gamma-thionin 28..70 CDD:278720 27/41 (66%)
Drsl5NP_647803.1 Gamma-thionin 26..68 CDD:395240 27/41 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448669
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0008543
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.