powered by:
Protein Alignment Drsl3 and LCR73
DIOPT Version :9
Sequence 1: | NP_728861.1 |
Gene: | Drsl3 / 317955 |
FlyBaseID: | FBgn0052283 |
Length: | 71 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001030952.1 |
Gene: | LCR73 / 3768036 |
AraportID: | AT2G02147 |
Length: | 80 |
Species: | Arabidopsis thaliana |
Alignment Length: | 72 |
Identity: | 23/72 - (31%) |
Similarity: | 29/72 - (40%) |
Gaps: | 11/72 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 6 FLFAILAVMTIVLMEANTVLARD---C--LSGTFGGPCWAWSGEKCRRLCIEEGHV-SGHC--SG 62
||..:|.:..:||.....|...| | .|..|.|.| .|...|..:|.:..|. .||| .|
plant 7 FLSVLLLIAFMVLATTAEVSPLDNKICKTRSDRFSGVC--ISTNNCAIICQQFEHFDGGHCEFDG 69
Fly 63 AM-KCWC 68
|. :|.|
plant 70 AFRRCMC 76
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1625543at2759 |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.010 |
|
Return to query results.
Submit another query.