DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drsl4 and Drsl6

DIOPT Version :10

Sequence 1:NP_728862.1 Gene:Drsl4 / 317954 FlyBaseID:FBgn0052282 Length:71 Species:Drosophila melanogaster
Sequence 2:NP_728873.1 Gene:Drsl6 / 38416 FlyBaseID:FBgn0052268 Length:72 Species:Drosophila melanogaster


Alignment Length:73 Identity:45/73 - (61%)
Similarity:53/73 - (72%) Gaps:3/73 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAQIKGLFALLAVVTIVLMVANSASAVDCPSGRFSGPCWAWDGEQCRRLCREE--GRVSGHCSAS 63
            |.|||.||..||::.:|::.|..|.| ||.|||:.|||..||.|.|||:||||  |||||||||.
  Fly     1 MMQIKFLFTFLALLMMVILGAKEADA-DCLSGRYRGPCAVWDNETCRRVCREEGRGRVSGHCSAR 64

  Fly    64 LKCWCEQC 71
            |:||||.|
  Fly    65 LQCWCEGC 72

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drsl4NP_728862.1 Gamma-thionin 28..70 CDD:395240 31/43 (72%)
Drsl6NP_728873.1 Gamma-thionin 27..71 CDD:395240 31/43 (72%)

Return to query results.
Submit another query.