DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Drsl4 and Drsl3

DIOPT Version :10

Sequence 1:NP_728862.1 Gene:Drsl4 / 317954 FlyBaseID:FBgn0052282 Length:71 Species:Drosophila melanogaster
Sequence 2:NP_728861.1 Gene:Drsl3 / 317955 FlyBaseID:FBgn0052283 Length:71 Species:Drosophila melanogaster


Alignment Length:71 Identity:49/71 - (69%)
Similarity:56/71 - (78%) Gaps:0/71 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MAQIKGLFALLAVVTIVLMVANSASAVDCPSGRFSGPCWAWDGEQCRRLCREEGRVSGHCSASLK 65
            |.|:..|||:|||:|||||.||:..|.||.||.|.||||||.||:|||||.|||.||||||.::|
  Fly     1 MVQMIFLFAILAVMTIVLMEANTVLARDCLSGTFGGPCWAWSGEKCRRLCIEEGHVSGHCSGAMK 65

  Fly    66 CWCEQC 71
            ||||.|
  Fly    66 CWCEGC 71

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Drsl4NP_728862.1 Gamma-thionin 28..70 CDD:395240 31/41 (76%)
Drsl3NP_728861.1 Gamma-thionin 28..70 CDD:395240 31/41 (76%)

Return to query results.
Submit another query.