DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32280 and Litaf

DIOPT Version :9

Sequence 1:NP_001286927.1 Gene:CG32280 / 317952 FlyBaseID:FBgn0052280 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001099205.1 Gene:Litaf / 65161 RGDID:69294 Length:161 Species:Rattus norvegicus


Alignment Length:163 Identity:61/163 - (37%)
Similarity:72/163 - (44%) Gaps:36/163 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKPGSAPPQFTYVPP--PSAPPSYQEAVG--------------------------GVKPVGPYT 37
            ||.||  |.|....|.  |:|||:|:|.||                          |:.|...||
  Rat     1 MSAPG--PYQAAAGPSVMPTAPPTYEETVGVNSYYPTPPAPQPGPATGLITGPDGKGMNPPSYYT 63

  Fly    38 PVVAPATTANTTIVTTVV---PIS--RTSTHMICPSCHAEIETTTRTEPGMIAYLSGFLIALFGC 97
            ..| |...||...|.||.   |||  .....|.||||:..|.|......|.:.:||...:.|.||
  Rat    64 QPV-PVPNANAIAVQTVYVQQPISFYDRPIQMCCPSCNKMIVTQLSYNAGALTWLSCGSLCLLGC 127

  Fly    98 WLGCCLIPCCIDDCMDVHHSCPNCRAYLGRYRR 130
            ..|||.||.|:|...||.|.||||:|.||.|:|
  Rat   128 VAGCCFIPFCVDALQDVDHYCPNCKALLGTYKR 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32280NP_001286927.1 zf-LITAF-like 60..129 CDD:402300 30/68 (44%)
LitafNP_001099205.1 PPxY motif. /evidence=ECO:0000250|UniProtKB:Q99732 20..23 2/2 (100%)
zf-LITAF-like 91..159 CDD:402300 30/67 (45%)
Membrane-binding amphipathic helix. /evidence=ECO:0000305 111..134 9/22 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CY6X
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 1 1.000 - - mtm12331
orthoMCL 1 0.900 - - OOG6_100529
Panther 1 1.100 - - LDO PTHR23292
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X238
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
109.820

Return to query results.
Submit another query.