DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32280 and cdip1

DIOPT Version :9

Sequence 1:NP_001286927.1 Gene:CG32280 / 317952 FlyBaseID:FBgn0052280 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001025631.1 Gene:cdip1 / 595019 XenbaseID:XB-GENE-5752851 Length:207 Species:Xenopus tropicalis


Alignment Length:179 Identity:54/179 - (30%)
Similarity:73/179 - (40%) Gaps:49/179 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKPGSAP-PQ-FTYVPPPSAPPSYQEAVGGV-------KPVGPYTP------------------ 38
            |.:|.:|| || ..:.||...||.|....|.:       .|.|||.|                  
 Frog    27 MEEPRAAPYPQAMPFAPPDCGPPPYDANPGYIAPNPGFYPPPGPYAPMGYYPPTPGQFQPPYPSQ 91

  Fly    39 ----------VVAPATTANTTIVTTVVPISRTST------------HMICPSCHAEIETTTRTEP 81
                      |:.|...::|:..|||...:.|.|            ..:|.:|...|.|....:.
 Frog    92 YPSPGAQGTAVIVPPGPSSTSAATTVTSTTTTVTVLQGEIFQGSPVQTVCTNCQQPITTKISHDI 156

  Fly    82 GMIAYLSGFLIALFGCWLGCCLIPCCIDDCMDVHHSCPNCRAYLGRYRR 130
            |::.:|........||.||||||||.|:|..||.||||||:.::..|||
 Frog   157 GLMNFLLCCFCCFVGCDLGCCLIPCIINDLKDVTHSCPNCKYHIYTYRR 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32280NP_001286927.1 zf-LITAF-like 60..129 CDD:402300 28/80 (35%)
cdip1NP_001025631.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..54 11/26 (42%)
zf-LITAF-like 135..204 CDD:402300 26/68 (38%)
Membrane-binding amphipathic helix. /evidence=ECO:0000305 161..183 11/21 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23292
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5213
SonicParanoid 1 1.000 - - X238
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.140

Return to query results.
Submit another query.