DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32280 and si:ch211-202h22.8

DIOPT Version :9

Sequence 1:NP_001286927.1 Gene:CG32280 / 317952 FlyBaseID:FBgn0052280 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001278864.1 Gene:si:ch211-202h22.8 / 559550 ZFINID:ZDB-GENE-090313-78 Length:137 Species:Danio rerio


Alignment Length:148 Identity:49/148 - (33%)
Similarity:62/148 - (41%) Gaps:30/148 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKPGSAPP---------QFT-----YVPPPSAPPSYQEAVGGVKPVGPYTPVV--APATTANTT 49
            |.|..:.||         |||     |.|.|..||         .|...:.|.|  :||....|.
Zfish     1 MEKGPALPPYSGPEVNQTQFTPYPVQYQPQPVYPP---------HPKDGFAPAVQSSPAPVVVTQ 56

  Fly    50 IVTTVVPISRTSTHMICPSCHAEIETTTRTEPGMIAYL--SGFLIALFGCWLGCCLIPCCIDDCM 112
            :|.....:|.......||.|..:|.|.||...|::.:|  .|..|.|.  | .|||||.|:..|.
Zfish    57 VVMMPPSLSDVPGQTKCPHCQQQIITETRYVNGLLTWLICGGLGILLI--W-PCCLIPFCVSACK 118

  Fly   113 DVHHSCPNCRAYLGRYRR 130
            ||.|.||||:..:..|:|
Zfish   119 DVEHRCPNCKHVVFLYKR 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32280NP_001286927.1 zf-LITAF-like 60..129 CDD:402300 27/70 (39%)
si:ch211-202h22.8NP_001278864.1 zf-LITAF-like 68..135 CDD:287559 27/69 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 71 0.820 Domainoid score I9359
eggNOG 1 0.900 - - E1_2CY6X
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 1 1.000 - - mtm6460
orthoMCL 1 0.900 - - OOG6_100529
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X238
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.810

Return to query results.
Submit another query.