DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32280 and si:ch211-202h22.9

DIOPT Version :9

Sequence 1:NP_001286927.1 Gene:CG32280 / 317952 FlyBaseID:FBgn0052280 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001139042.1 Gene:si:ch211-202h22.9 / 559480 ZFINID:ZDB-GENE-030131-1143 Length:140 Species:Danio rerio


Alignment Length:129 Identity:47/129 - (36%)
Similarity:60/129 - (46%) Gaps:23/129 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PGSAPPQFTYVPPPSAPPSYQEAVGGVKPVGPYT--PVVAPATTANTTIVTTVVPISRTSTHMIC 66
            |.:.|....|.|||..|              |||  |:..|......|.:|.|      ...:.|
Zfish    31 PPAGPQAAPYQPPPYGP--------------PYTSQPMPIPVQQMPLTSLTDV------PGRITC 75

  Fly    67 PSCHAEIETTTRTEPGMIAYLSGFLIALFGCWLGCCLIPCCIDDCMDVHHSCPNCRAYLGRYRR 130
            |.|..|:.|.|....|::|:|....:|||.||| ||.||.|:|.|.||.|:|||||..:..|:|
Zfish    76 PHCLTEVITETEHVSGLMAWLICGTLALFVCWL-CCCIPFCLDACKDVKHTCPNCRNIIRIYKR 138

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32280NP_001286927.1 zf-LITAF-like 60..129 CDD:402300 30/68 (44%)
si:ch211-202h22.9NP_001139042.1 zf-LITAF-like 70..137 CDD:287559 30/67 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 71 0.820 Domainoid score I9359
eggNOG 1 0.900 - - E1_2CY6X
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 1 1.000 - - mtm6447
orthoMCL 1 0.900 - - OOG6_100529
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X238
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
109.820

Return to query results.
Submit another query.