DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32280 and cdip1

DIOPT Version :9

Sequence 1:NP_001286927.1 Gene:CG32280 / 317952 FlyBaseID:FBgn0052280 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001092712.1 Gene:cdip1 / 557073 ZFINID:ZDB-GENE-070720-18 Length:213 Species:Danio rerio


Alignment Length:178 Identity:52/178 - (29%)
Similarity:67/178 - (37%) Gaps:55/178 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 SAPPQFTYVPPPSAPPSYQEA---------VGGVKPV---------------GPYTP-------- 38
            :.|||...:||...||.|:..         |.|..|:               |.|.|        
Zfish    36 TGPPQGHPLPPEYGPPPYEATQQPGFVPPHVPGEGPIPKPMHMPMPMPHPHGGYYPPLGHFPHTM 100

  Fly    39 ------------------VVAPATTANTTIVTTVVP---ISRTSTHMICPSCHAEIETTTRTEPG 82
                              |:||...|.||:  ||:.   ........:||.|...|.|....:.|
Zfish   101 GEYAGPGPSHFAPGHTATVLAPPGAATTTV--TVLQGEMFQSAPVQTVCPHCQQPIITRISHDIG 163

  Fly    83 MIAYLSGFLIALFGCWLGCCLIPCCIDDCMDVHHSCPNCRAYLGRYRR 130
            ::..|........||.||||||||.|||..||.|:||||:.|:..|:|
Zfish   164 LMNTLVCMFCFFVGCDLGCCLIPCLIDDLKDVTHTCPNCKGYIYTYKR 211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32280NP_001286927.1 zf-LITAF-like 60..129 CDD:402300 28/68 (41%)
cdip1NP_001092712.1 zf-LITAF-like 142..210 CDD:287559 28/67 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CY6X
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I5194
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm6460
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R5213
SonicParanoid 1 1.000 - - X238
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
98.960

Return to query results.
Submit another query.