DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32280 and Gm5767

DIOPT Version :9

Sequence 1:NP_001286927.1 Gene:CG32280 / 317952 FlyBaseID:FBgn0052280 Length:130 Species:Drosophila melanogaster
Sequence 2:XP_030105031.1 Gene:Gm5767 / 436336 MGIID:3643507 Length:135 Species:Mus musculus


Alignment Length:142 Identity:50/142 - (35%)
Similarity:67/142 - (47%) Gaps:28/142 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKPGSAPP---QFTYVPPPSAPPSYQ-EAVGGVKPV------GPYTPVVAPATTANTTIVTTVV 55
            :::.|...|   |....||.|.|||.: ....||.||      ||:|.:         ..:.|.:
Mouse     7 LARSGRTWPDVRQSRETPPSSYPPSSRGPGSPGVYPVYNQVPPGPFTGI---------PYMPTSI 62

  Fly    56 PISRTSTHMICPSCHAEIETTTRTEPGMIAYL--SGFLIALFGCWLGCCLIPCCIDDCMDVHHSC 118
            |:     ..:||.|...|.|.|...||::.:|  ||..:  |||:|||||||.||...|||.|||
Mouse    63 PV-----QAVCPYCGNRIMTVTTYTPGLLTWLLCSGLFV--FGCFLGCCLIPFCIRSTMDVTHSC 120

  Fly   119 PNCRAYLGRYRR 130
            |.|...:..:.|
Mouse   121 PMCHHQIYYFHR 132

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32280NP_001286927.1 zf-LITAF-like 60..129 CDD:402300 31/70 (44%)
Gm5767XP_030105031.1 zf-LITAF-like 63..131 CDD:371158 32/74 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 1 1.000 - - mtm8839
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X238
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.020

Return to query results.
Submit another query.