DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG32280 and litaf

DIOPT Version :9

Sequence 1:NP_001286927.1 Gene:CG32280 / 317952 FlyBaseID:FBgn0052280 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001002184.1 Gene:litaf / 431731 ZFINID:ZDB-GENE-040704-23 Length:163 Species:Danio rerio


Alignment Length:160 Identity:49/160 - (30%)
Similarity:63/160 - (39%) Gaps:30/160 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKPGSAPPQFTYVPPPSAPPSYQEAVGG--VKPVGPY--------------------------- 36
            |..|.:.|.:.|.:.....||||.|..|.  ..|.|||                           
Zfish     3 MPMPTAPPMENTTLVGHPPPPSYDEISGANPYYPAGPYPPADMKASGPPPYPTQEYNQMYPPTAQ 67

  Fly    37 -TPVVAPATTANTTIVTTVVPISRTSTHMICPSCHAEIETTTRTEPGMIAYLSGFLIALFGCWLG 100
             .||.:|.....|..|...:..........||.|...:.|......|.:.:||...:|:|||..|
Zfish    68 GQPVTSPVVAVQTVYVQPGLVFGNVPVQAHCPVCSQSVITRLEYSSGPLVWLSCAGLAVFGCIYG 132

  Fly   101 CCLIPCCIDDCMDVHHSCPNCRAYLGRYRR 130
            |||||.||:|..||.|.||||.:.||.::|
Zfish   133 CCLIPFCIEDLKDVTHHCPNCSSVLGVHKR 162

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG32280NP_001286927.1 zf-LITAF-like 60..129 CDD:402300 29/68 (43%)
litafNP_001002184.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23 4/19 (21%)
PPxY motif. /evidence=ECO:0000250|UniProtKB:Q99732 22..25 2/2 (100%)
zf-LITAF-like 93..161 CDD:287559 29/67 (43%)
Membrane-binding amphipathic helix. /evidence=ECO:0000305 116..136 9/19 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I5194
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1564782at2759
OrthoFinder 1 1.000 - - FOG0000358
OrthoInspector 1 1.000 - - mtm6622
orthoMCL 1 0.900 - - OOG6_100529
Panther 1 1.100 - - LDO PTHR23292
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X238
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.970

Return to query results.
Submit another query.